DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and AYR1

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_012142.3 Gene:AYR1 / 854682 SGDID:S000001386 Length:297 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:51/233 - (21%)
Similarity:97/233 - (41%) Gaps:31/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KGVLITGCEAPLAWYLAKKLDDLGFTVYAGFN--TPIEESDEAKILKEVTSGRMKLLHLDVTSEK 158
            |..::||....:.:.:.|:|...|:.|||...  .|:     |::..:..:..:|...||::..:
Yeast    10 KIAVVTGASGGIGYEVTKELARNGYLVYACARRLEPM-----AQLAIQFGNDSIKPYKLDISKPE 69

  Fly   159 TILEAARYVSQHLPHGAEGLW--SVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLP 221
            .|:..:.::..:||.|...|.  :......:.||...:    |.:.:...:|:.|...:.:....
Yeast    70 EIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATD----AAVEQCFKVNVFGHINMCRELSE 130

  Fly   222 LVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFA---- 282
            .:.:|.|.:||..|....|..|...|..|::||:..:|..|..||:...|.|.....|..|    
Yeast   131 FLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFNVRVINAITGGVATDIA 195

  Fly   283 ---PGNGWLNETELRD--QAKQMWNQLSSEQKKTYGED 315
               |    |.||.:.:  :.::.:|     .:||..:|
Yeast   196 DKRP----LPETSIYNFPEGREAFN-----SRKTMAKD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 51/233 (22%)
adh_short 96..293 CDD:278532 47/207 (23%)
AYR1NP_012142.3 17beta-HSD-like_SDR_c 10..256 CDD:187632 51/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.