DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and HSD6

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_199890.1 Gene:HSD6 / 835149 AraportID:AT5G50770 Length:342 Species:Arabidopsis thaliana


Alignment Length:266 Identity:67/266 - (25%)
Similarity:109/266 - (40%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ISSISTFAVFVWFALATVGAVL-FY--------------HFVKVSASGKGVLITGCEA----PLA 108
            :.||:....|: |.|.|:.|:| ||              :....:.:||.|:|||..:    .||
plant     1 MDSINKIINFL-FPLLTLYALLVFYPTYQRLKSAVSICRNLFSENVAGKVVVITGAASGIGEALA 64

  Fly   109 WYLAKKLDDLGFTVYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPH 173
            :...|:...|......|     |.......|.|: .|..::|.| |.....:.:..|::...:.|
plant    65 YEYGKRGAYLALVDIRG-----EPLFHVAALAEL-YGSPEVLPL-VADVSKLQDCERFIRATVLH 122

  Fly   174 --GAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVRRAHGRVVFLTSG 236
              ..:.|.:....|......::|.:..|  ..::|:|..||...|....|.:::..||:|.:.||
plant   123 FGRLDHLVTNAGVAPLYFFADIEDVSKA--SPAMDINFWGSVYCTFFASPYLKKFRGRIVVIASG 185

  Fly   237 LNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSV-----------VAAGEFAPGNGWL-N 289
            ...:.||.....||::|||..|...||.|.   |.|:.|           ::.|:|...:|.| .
plant   186 CGYIASPRLSFYCASKAAVIAFYETLRTEF---GSDIGVTIVAPGIVDSEMSRGKFMTKDGKLVV 247

  Fly   290 ETELRD 295
            :.||||
plant   248 DKELRD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 56/218 (26%)
adh_short 96..293 CDD:278532 52/214 (24%)
HSD6NP_199890.1 NADB_Rossmann 45..305 CDD:304358 57/221 (26%)
PRK06181 47..307 CDD:235726 57/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.