DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and HSD1

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_680418.1 Gene:HSD1 / 835141 AraportID:AT5G50700 Length:349 Species:Arabidopsis thaliana


Alignment Length:323 Identity:82/323 - (25%)
Similarity:133/323 - (41%) Gaps:43/323 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TFAVFVWFALA-TVGAVLFYHFVKVSAS--------GKGVLITGCEAPLAWYLAKKLDDLG--FT 121
            |...|.:|.|. .:....|:.|::...|        ||.|||||..:.:...||.:....|  ..
plant    11 TAPFFTFFGLCFFLPPFYFFKFLQSIFSTIFSENLYGKVVLITGASSGIGEQLAYEYACRGACLA 75

  Fly   122 VYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAH 186
            :.|.....:||  .|:|.:|:.|..:..:|.||:...   :..|.|...:.|... |..:|:.|.
plant    76 LTARRKNRLEE--VAEIARELGSPNVVTVHADVSKPD---DCRRIVDDTITHFGR-LDHLVNNAG 134

  Fly   187 WIALGELEWIPFAVLRKS-LDLNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCA 250
            ...:...|.|......|: ||.|..||...|:..||.:|:::|::|.::|....:.:|......|
plant   135 MTQISMFENIEDITRTKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNA 199

  Fly   251 TQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAKQMWNQLSSEQKKTYGED 315
            ::||:..|...:|.|:   |.||.:...   .||   ..|:|| .|.|    ..|.|.:....:|
plant   200 SKAALLSFFETMRIEL---GGDVHITIV---TPG---YIESEL-TQGK----YFSGEGELIVNQD 250

  Fly   316 YYEAAMTSVEKYSRQAADIQPTLRVLIDAVTRTFPMARYTPVTSSERLQI-FLAEHLAPSLYE 377
                 |..|:......|......:.:::.|.|   ..||  ||.....:: :|.:.|.|.|.|
plant   251 -----MRDVQVGPFPVASASGCAKSIVNGVCR---KQRY--VTEPSWFKVTYLWKVLCPELIE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 74/286 (26%)
adh_short 96..293 CDD:278532 53/199 (27%)
HSD1NP_680418.1 NADB_Rossmann 47..304 CDD:419666 75/287 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.