DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and HSD2

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001154667.1 Gene:HSD2 / 823889 AraportID:AT3G47350 Length:321 Species:Arabidopsis thaliana


Alignment Length:288 Identity:63/288 - (21%)
Similarity:115/288 - (39%) Gaps:73/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VTSHLLHALDISSISTFAVFVWFALATVGAVLFYHFVKVSASGKGVLITGCEAPL----AWYLAK 113
            :.:.||..|.||.:..|..|..|. ..:..:...||..|  :||.|||||..:.:    |:..||
plant     7 ILNFLLPPLTISFLVLFYPFYLFT-KLMSCLKHLHFENV--TGKVVLITGASSGIGEHVAYEYAK 68

  Fly   114 KLDDLGFTVYAGFNTPIEESDEAKILKEVT----SGRMKLLHLDVTSEKTILEAARYVSQHLPHG 174
            |...|....        ...|..:|:.|.:    ||.:.::..||::   :.:..:::.:.:.| 
plant    69 KGAKLALVA--------RRKDRLEIVAETSRQLGSGDVIIIPGDVSN---VEDCKKFIDETIHH- 121

  Fly   175 AEGLWSVVHCAHWIALGELE------WIPFAVL----------RKSLDLNLLGSARLTQIFLPLV 223
                           .|:|:      .:|..|:          ...:|:|..||..:|...:|.:
plant   122 ---------------FGKLDHLINNAGVPQTVIFEDFTQIQDANSIMDINFWGSTYITYFAIPHL 171

  Fly   224 RRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWL 288
            |::.|::|.::|....:|.....:..|::||:..|...||.|:   ..|:.:..|   .|  |::
plant   172 RKSKGKIVVISSATAIIPLQAASVYSASKAALVKFFETLRVEI---SPDIKITIA---LP--GFI 228

  Fly   289 NETELRDQAKQMWNQLSSEQKKTYGEDY 316
            :......|.|:|           ||.|:
plant   229 STDMTTPQFKEM-----------YGSDF 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 51/245 (21%)
adh_short 96..293 CDD:278532 45/220 (20%)
HSD2NP_001154667.1 NADB_Rossmann 44..262 CDD:304358 53/250 (21%)
adh_short 47..240 CDD:278532 47/227 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.