DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and MGC147117

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_012816771.1 Gene:MGC147117 / 779842 XenbaseID:XB-GENE-5918131 Length:251 Species:Xenopus tropicalis


Alignment Length:226 Identity:47/226 - (20%)
Similarity:100/226 - (44%) Gaps:30/226 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VLITGCEAPLAWYLAKKL---DDLGFTVYAGFNTP-IEESDEAKILKEVTSGRMKLLHLDVTSEK 158
            ||:||....:.:...::.   .:....::|....| .::|.|.|.|.|..| .:.::.||.|:..
 Frog     9 VLVTGSNRGIGYEFVQQFLNSQNPPQKIFATCRDPGAQQSQELKNLSEKHS-NVVVIQLDTTNPA 72

  Fly   159 TILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLV 223
            ::..:.:.|.:||  ..:||..:::.|..:....||......:....::|::|....||.:..|:
 Frog    73 SVNASVKEVEKHL--NGQGLDLLINNAGILNHNSLETQTAEDMMHVYNVNVVGPMLTTQAYHHLL 135

  Fly   224 RR----AHGR-----VVFLTSGLNRVPS-----PVRGIQCATQAAVDCFAACLRQEMRTRGVDVS 274
            :|    :.|:     :..|...|..:|.     ||...:| ::||::..:.|..:..:..|: :|
 Frog   136 KRSVVESSGKSAIVHISALLGSLEELPHLFSALPVISYRC-SKAALNILSRCHMEGYKQDGI-IS 198

  Fly   275 VVAAGEFAPGNGWLNETELRDQAKQMWNQLS 305
            :      |...||: :|::..:...:..|.|
 Frog   199 I------AIHPGWV-QTDMGGEKAPITKQTS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 47/226 (21%)
adh_short 96..293 CDD:278532 45/212 (21%)
MGC147117XP_012816771.1 carb_red_sniffer_like_SDR_c 9..251 CDD:187586 47/226 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.