DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Rdh8

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001162065.1 Gene:Rdh8 / 690953 RGDID:1589829 Length:312 Species:Rattus norvegicus


Alignment Length:293 Identity:68/293 - (23%)
Similarity:119/293 - (40%) Gaps:56/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VLITGCEAPLAWYLAKKL---DDLGFTVYA-----GFNTPIEESDEAKILKEVTSGRMKLLHLDV 154
            |||:||.:.:...||.:|   ....:.|.|     |...|:|.:     ..|.....:.:..|||
  Rat     8 VLISGCSSGIGLELAVQLAHDPRQRYQVVATMRDLGKKEPLEAA-----AGEALGKTLSVAQLDV 67

  Fly   155 TSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIF 219
            .|::::....    .|:..|...:  :|:.|....:|.||.:..|.::...:.|..|:.||.:..
  Rat    68 CSDESVTNCL----SHIEGGQVDI--LVNNAGVGLVGPLEDLSLATMQNVFNTNFFGAVRLVKAV 126

  Fly   220 LP-LVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAG---- 279
            || :.||..|.:|.::|.:.........:..|::.|::.|...|..::|...:.:|:|..|    
  Rat   127 LPGMKRRRQGHIVVVSSVMGLQGVMFNDVYAASKFALEGFFESLAIQLRQFNIFISMVEPGPVIT 191

  Fly   280 EFAPGNGWL----NETELRDQAKQMWNQLSSEQKKTYGEDYYEAA----MTSVEKYSRQAADIQP 336
            :|   .|.|    ::||..|         :..:...|..|.|..|    ..||.:..|..|    
  Rat   192 DF---EGKLLAQVSKTEFPD---------TDPETLGYFRDLYLPASRELFRSVGQSPRDVA---- 240

  Fly   337 TLRVLIDAVTRTFP------MARYTPVTSSERL 363
              :|:...:..|.|      .|||.|:|:.:.|
  Rat   241 --QVIAKVIGSTRPPLRRQTNARYFPLTALKAL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 68/293 (23%)
adh_short 96..293 CDD:278532 49/211 (23%)
Rdh8NP_001162065.1 NADB_Rossmann 8..262 CDD:304358 63/282 (22%)
adh_short 8..201 CDD:278532 48/206 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.