DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and BDH1

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_011511369.1 Gene:BDH1 / 622 HGNCID:1027 Length:347 Species:Homo sapiens


Alignment Length:286 Identity:95/286 - (33%)
Similarity:153/286 - (53%) Gaps:1/286 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTI 160
            |.||:|||::...:.|||.|...||.|:||.....:..|..|.|..:.|.|::.:.|:|.|.:.:
Human    60 KAVLVTGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEV 124

  Fly   161 LEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVRR 225
            .:....|...|....:|:|.:|:.|.....||:|:......::..::||.|:.|:|:.||||:||
Human   125 EKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFLPLIRR 189

  Fly   226 AHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNE 290
            |.||||.::|.|.|:.:|.|...|.|:..|:.|:.|||.||...||.||||..|.|.......:.
Human   190 AKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSP 254

  Fly   291 TELRDQAKQMWNQLSSEQKKTYGEDYYEAAMTSVEKY-SRQAADIQPTLRVLIDAVTRTFPMARY 354
            ..::..||:||.:|....:|.||:.|::..:..:|.| |..:.|..|.:..:..|:|.|.|..||
Human   255 ESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRY 319

  Fly   355 TPVTSSERLQIFLAEHLAPSLYESLY 380
            .|:.....|::.:..||..::.:.:|
Human   320 HPMDYYWWLRMQIMTHLPGAISDMIY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 94/284 (33%)
adh_short 96..293 CDD:278532 70/196 (36%)
BDH1XP_011511369.1 type2_17beta_HSD-like_SDR_c 60..345 CDD:187665 94/284 (33%)
adh_short 60..245 CDD:278532 69/184 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5479
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4137
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48608
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm41558
orthoMCL 1 0.900 - - OOG6_109704
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.