DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and si:dkey-12e7.4

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001137514.1 Gene:si:dkey-12e7.4 / 558132 ZFINID:ZDB-GENE-050419-83 Length:256 Species:Danio rerio


Alignment Length:199 Identity:42/199 - (21%)
Similarity:85/199 - (42%) Gaps:33/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VLITGCEAPLAWYLAKKLDDLGFT---VYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKT 159
            ::|||....|...:.:.|...||:   :.|....|....:..::.:|..:  :.::.|||.|:::
Zfish    11 LMITGASRGLGLQIVESLVTGGFSPGKIIATARNPNGAKELQRLAEEYQN--IHIIKLDVISQES 73

  Fly   160 ILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVR 224
            |..||..|.:.:..  |||..:::.|....:..||.:....:.::...|.:....:|:..|||::
Zfish    74 IERAAAEVEELVQE--EGLNCLINNAGINVVANLETVTADQMLENFHTNSVAPLMITKAMLPLLK 136

  Fly   225 RAHGR----------VVFLTSGLNRVP------------SPVRGIQCATQAAVDCFAACLRQEMR 267
            ||..:          |:.:||.|..|.            .|.|    .:::|::....||..::.
Zfish   137 RAAAKGTGMGIHRAAVINVTSLLGSVELYWGDRADTFKWYPYR----TSKSALNMVTRCLAVDLE 197

  Fly   268 TRGV 271
            ..|:
Zfish   198 ADGI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 42/199 (21%)
adh_short 96..293 CDD:278532 42/199 (21%)
si:dkey-12e7.4NP_001137514.1 carb_red_sniffer_like_SDR_c 12..256 CDD:187586 42/198 (21%)
adh_short 13..218 CDD:278532 42/197 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.