Sequence 1: | NP_610724.1 | Gene: | CG8888 / 36293 | FlyBaseID: | FBgn0033679 | Length: | 388 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137514.1 | Gene: | si:dkey-12e7.4 / 558132 | ZFINID: | ZDB-GENE-050419-83 | Length: | 256 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 42/199 - (21%) |
---|---|---|---|
Similarity: | 85/199 - (42%) | Gaps: | 33/199 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 VLITGCEAPLAWYLAKKLDDLGFT---VYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKT 159
Fly 160 ILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVR 224
Fly 225 RAHGR----------VVFLTSGLNRVP------------SPVRGIQCATQAAVDCFAACLRQEMR 267
Fly 268 TRGV 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8888 | NP_610724.1 | NADB_Rossmann | 96..380 | CDD:304358 | 42/199 (21%) |
adh_short | 96..293 | CDD:278532 | 42/199 (21%) | ||
si:dkey-12e7.4 | NP_001137514.1 | carb_red_sniffer_like_SDR_c | 12..256 | CDD:187586 | 42/198 (21%) |
adh_short | 13..218 | CDD:278532 | 42/197 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1390068at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |