DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and rdh5

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001025272.1 Gene:rdh5 / 556528 ZFINID:ZDB-GENE-050208-411 Length:328 Species:Danio rerio


Alignment Length:301 Identity:93/301 - (30%)
Similarity:149/301 - (49%) Gaps:31/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SISTFA---VFVWFALATVGAVLFYHFVKVS-ASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAG 125
            ::.|||   |.|||         :...:|:: .|.|.|.:|||::.....|.|:||..||.|.||
Zfish    14 ALGTFAILWVLVWF---------YRDNLKITRVSEKHVFVTGCDSGFGNLLCKRLDKRGFRVLAG 69

  Fly   126 FNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCA-HWIA 189
            ..|.....|    ||......:|...|||||..:|.:|..:....:  |.:|||.:|:.| ..:.
Zfish    70 CLTEKGADD----LKRAAGPFLKTCILDVTSSASIQKAMEWTKNEV--GDKGLWGLVNNAGRSLP 128

  Fly   190 LGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAA 254
            :|..||:.......:|.:|:.|....|..|||||::|.||:|.:.|.|.||.:...| .|.::.|
Zfish   129 MGPSEWMKIEDFESTLKVNMTGVIETTMTFLPLVKKARGRIVNVASVLGRVAANGGG-YCISKFA 192

  Fly   255 VDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLN--ETELRDQAKQMWNQLSSEQKKTYGEDYY 317
            |:.|:.|||::::..||:|.::..|.|......|.  |.||.    ::||||:.|.|::||:.|.
Zfish   193 VESFSDCLRRDIQGFGVNVCIIEPGFFKTQVTSLEPIERELH----RLWNQLTPEVKESYGDKYL 253

  Fly   318 EAAMTSVEKYSRQA---ADIQPTLRVLIDAVTRTFPMARYT 355
            :..:. :::....|   :|:......:..|:....|..||:
Zfish   254 DKYIW-IQRLIMNAICDSDLSKVTNCMEHALLAVHPRTRYS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 84/266 (32%)
adh_short 96..293 CDD:278532 67/199 (34%)
rdh5NP_001025272.1 NADB_Rossmann 40..314 CDD:304358 84/266 (32%)
adh_short 40..224 CDD:278532 65/190 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4870
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48608
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm25684
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.