DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and zgc:110339

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001017792.1 Gene:zgc:110339 / 550490 ZFINID:ZDB-GENE-050417-323 Length:255 Species:Danio rerio


Alignment Length:212 Identity:47/212 - (22%)
Similarity:92/212 - (43%) Gaps:42/212 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 HFVKVSASGKGVLITGCEAPLAWYLAKKL---DDLGFTVYAGFNTPIEESDEAKILKEVTSGRMK 148
            :|.|..:    |||||....|...:.|:|   .:....:.|....|....:..|:.|  ....:.
Zfish     4 NFAKCGS----VLITGASRGLGLQMVKQLLATPERPQKIIATVRNPAAAEELQKLAK--AHPDVH 62

  Fly   149 LLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALG---ELEWIPFAVLRKSLDLNLL 210
            ::.||:::|.::..|::.|...:  ||.||..:::.|   |:|   :|:.:...|:.|:.:.|.:
Zfish    63 IVTLDISNETSVNAASQAVEAIV--GANGLNCLINNA---AIGMSSDLDSVTRDVMMKTYESNTV 122

  Fly   211 GSARLTQIFLPLVRRAHGRVVFLTSGLN-------RVPSPVRGIQC--------------ATQAA 254
            ....:|:..|||:|||...    .||::       .|.|.:..:|.              |:::|
Zfish   123 SPLFVTKALLPLLRRAAAE----GSGMSIQRAAVVNVSSLLGSVQLNWGEGASFKSYAYRASKSA 183

  Fly   255 VDCFAACLRQEMRTRGV 271
            ::....||..::...|:
Zfish   184 LNMVTRCLAADLEADGI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 45/203 (22%)
adh_short 96..293 CDD:278532 45/203 (22%)
zgc:110339NP_001017792.1 carb_red_sniffer_like_SDR_c 11..255 CDD:187586 45/201 (22%)
adh_short 11..217 CDD:278532 45/201 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.