DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and RDH8

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_056540.3 Gene:RDH8 / 50700 HGNCID:14423 Length:311 Species:Homo sapiens


Alignment Length:302 Identity:65/302 - (21%)
Similarity:122/302 - (40%) Gaps:69/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VSASGKGVLITGCEAPLAWYLAKKL--------------DDLGFTVYAGFNTPIEESDEAKILKE 141
            ::|:.:.|||:||.:.:...||.:|              .|||          .:|:.|| ...|
Human     1 MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLG----------KKETLEA-AAGE 54

  Fly   142 VTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLD 206
            .....:.:..|||.|::::.:....:...:.       .:|:.|....:|.||.:..|.::...|
Human    55 ALGQTLTVAQLDVCSDESVAQCLSCIQGEVD-------VLVNNAGMGLVGPLEGLSLAAMQNVFD 112

  Fly   207 LNLLGSARLTQIFLP-LVRRAHGRVVFLTSGLNRVPSPVRGIQ--------CATQAAVDCFAACL 262
            .|..|:.||.:..|| :.||..|.:|.::|        |.|:|        .|::.|::.|...|
Human   113 TNFFGAVRLVKAVLPGMKRRRQGHIVVISS--------VMGLQGVIFNDVYAASKFALEGFFESL 169

  Fly   263 RQEMRTRGVDVSVVAAG----EFAPGNGWLNETELRDQAKQMWNQLSSEQKKTYGEDYYEAAMTS 323
            ..::....:.:|:|..|    ||        |.:|..|........:..:...|..|.|..|  |
Human   170 AIQLLQFNIFISLVEPGPVVTEF--------EGKLLAQVSMAEFPGTDPETLHYFRDLYLPA--S 224

  Fly   324 VEKYSRQAADIQPTLRVLIDAVTRTFP------MARYTPVTS 359
            .:.:.....:.|..::.:::.::.|.|      ..||:|:|:
Human   225 RKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 64/297 (22%)
adh_short 96..293 CDD:278532 50/223 (22%)
RDH8NP_056540.3 type1_17beta-HSD-like_SDR_c 6..262 CDD:187666 61/291 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.