DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and RGD1561812

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_038936531.1 Gene:RGD1561812 / 503146 RGDID:1561812 Length:249 Species:Rattus norvegicus


Alignment Length:230 Identity:62/230 - (26%)
Similarity:106/230 - (46%) Gaps:22/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 HLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARL 215
            ||.:.|||.  |:.:.....:|   ..|..|.:....|..|..||:........||:||||...:
  Rat    25 HLFLKSEKA--ESLKRDCWLIP---RTLGLVTNAGISIPTGPSEWLNKQDFASVLDVNLLGVIEV 84

  Fly   216 TQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGE 280
            |...:|.||:|.|.||.:.|.::|| |...|..|.::..|:.|:..||:|:...||.|::|..|.
  Rat    85 TLSMVPSVRKARGPVVNIASVMDRV-SSFGGGYCISKYGVEAFSDSLRRELSYFGVKVAIVGPGF 148

  Fly   281 FAPGNGWLNETELRDQAKQMWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQAADIQPTLRVLIDAV 345
            |.  ....|...|....:.:|::.|||.::.|||:|..:.:..:::..::.:..       :..|
  Rat   149 FR--TNMSNSAILSSNFQMLWDETSSEVREVYGENYLASCLIRLKRLDQRCSKD-------LSLV 204

  Fly   346 TRTFPMARYTPVTSSERLQIFLAEHLAPSLYESLY 380
            |...|..||:....::.:.:       |.:|.|.:
  Rat   205 TACHPRTRYSAGWDAKIIYL-------PMIYVSTF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 62/228 (27%)
adh_short 96..293 CDD:278532 45/141 (32%)
RGD1561812XP_038936531.1 NADB_Rossmann <48..238 CDD:419666 54/202 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.