DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and zgc:92161

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001004556.2 Gene:zgc:92161 / 447817 ZFINID:ZDB-GENE-040912-22 Length:258 Species:Danio rerio


Alignment Length:261 Identity:58/261 - (22%)
Similarity:109/261 - (41%) Gaps:36/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KVSASGKGVLITGCEAPLAWYLAKKLDDLGFT---VYAGFNTPIEESDEAKILKEVTS---GRMK 148
            :|.||  .:||||....|...:.|:|.:....   |:|....|  |...::.|:|:..   ..:.
Zfish     3 EVKAS--NILITGANRGLGLEMVKQLSENSCPNQHVFATCRDP--EGPRSEALRELAKKYPSVIT 63

  Fly   149 LLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSA 213
            ::.||.....:|.|:|:.|...|  ||.||..:|:.|..:|.|.::......::.|.:.|::|..
Zfish    64 IIRLDADDPCSIKESAKKVGALL--GANGLNLLVNNAAILARGIIKTSQAEDMKNSFNTNVIGPL 126

  Fly   214 RLTQIFLPLVR---RAHG------------RVVFLTSGLNRVPS-----PVRGIQCATQAAVDCF 258
            .:.|.:||.::   :|.|            .:..|...:.::|:     ||.. .|.::|..:..
Zfish   127 LIIQEYLPYLQTAAKASGTPGMSSNKAAIINISTLGGSMTKMPAMFSQFPVLP-YCVSKAGFNML 190

  Fly   259 AACLRQEMRTRGVDVSVVAAGEFAPGNGWLNET-ELRDQAKQMWNQLSSEQKKTYGE--DYYEAA 320
            .....:|::...:...|:..|......|..|.| |.::..:.|...:....:|.:|.  ||..|.
Zfish   191 TVLAAEEVKGDEILCMVLHPGWVKTDLGGKNATLEPKESVEGMLRVIGGLTEKEHGGFLDYTGAT 255

  Fly   321 M 321
            :
Zfish   256 L 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 55/255 (22%)
adh_short 96..293 CDD:278532 48/223 (22%)
zgc:92161NP_001004556.2 adh_short 8..220 CDD:278532 46/216 (21%)
carb_red_sniffer_like_SDR_c 9..258 CDD:187586 55/253 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.