DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and CG13833

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster


Alignment Length:235 Identity:43/235 - (18%)
Similarity:83/235 - (35%) Gaps:54/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LLHALDISSISTFAVFVWFALATVG---AVLFYHFVKVSASGKGVLITGCEAPLAWYLAKKLDDL 118
            ::..:.:::|:...:.|    |.:|   |.|.:.....|.:|:..::||....|...::.:|...
  Fly    15 IIALIGLAAITPLLILV----ALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKK 75

  Fly   119 GFTV-YAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVV 182
            |..: ....|....| |..|.::::...|.|....:||:...::|....|.:             
  Fly    76 GCHIAVVDINVSGAE-DTVKQIQDIYKVRAKAYKANVTNYDDLVELNSKVVE------------- 126

  Fly   183 HCAHWIALGELEWIPFAVLRKS--------------LDLNLLGSARLTQ------IFLPLVRRAH 227
                       |..|..||..:              .|:.|:.:..||.      :|||.::...
  Fly   127 -----------EMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELR 180

  Fly   228 -GRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEM 266
             |.:|.::|.....|.|.......|::........||.|:
  Fly   181 KGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMEL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 35/193 (18%)
adh_short 96..293 CDD:278532 35/193 (18%)
CG13833NP_651111.1 adh_short 53..241 CDD:278532 35/193 (18%)
NADB_Rossmann 54..297 CDD:304358 35/192 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.