DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and dhrs9

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001001191.1 Gene:dhrs9 / 407852 XenbaseID:XB-GENE-973205 Length:322 Species:Xenopus tropicalis


Alignment Length:305 Identity:83/305 - (27%)
Similarity:155/305 - (50%) Gaps:31/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VGAVLFYHFVKV-------SASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAK 137
            :|..:.|.:.:|       :.:.|.:|||||:.....:.||..|..||.:.|   |.:.|:. |.
 Frog     7 IGVAILYIWWRVRDGLKINNITEKYILITGCDTGFGNHAAKTFDKQGFRILA---TCLTEAG-AT 67

  Fly   138 ILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWI-ALGELEWIPFAVL 201
            .|:|.||.|:|...||||..:.::..|.:|...:  |:.|||.:::.|..: .|...:|:....:
 Frog    68 GLREATSQRLKTTLLDVTIAENVVSMAEWVKGEV--GSRGLWGLINNAGVMGTLAPFDWLTIEDI 130

  Fly   202 RKSLDLNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEM 266
            :|.:::||:|...:|.:.||.:::|.||::.::|...||.:. .|...:::..|:.|...||::|
 Frog   131 KKPMEINLIGLIHVTLVLLPFIKKAKGRIINVSSIGGRVAAS-GGAYFSSKFGVEGFNDSLRRDM 194

  Fly   267 RTRGVDVSVVAAGEFAPGNGWLNETELRD------QAKQMWNQLSSEQKKTYGEDYYEAAMTSVE 325
            :..||.||.:..|.|        :|.|.|      |...:|.:|.:|.:|.||::|.:...:..:
 Frog   195 KAFGVQVSCIEPGLF--------KTPLSDPKKVLQQRTDIWKRLPTEIQKEYGDNYIQIDASKKQ 251

  Fly   326 KYSRQA--ADIQPTLRVLIDAVTRTFPMARYTPVTSSERLQIFLA 368
            |.:::.  .|:...::.:..|:|...|..||:..:.:..|.|.|:
 Frog   252 KLNQRILNTDLSLVVQCMEHALTSRHPRTRYSAGSDAAFLWIPLS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 80/282 (28%)
adh_short 96..293 CDD:278532 60/197 (30%)
dhrs9NP_001001191.1 type2_17beta_HSD-like_SDR_c 30..307 CDD:187665 80/282 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.