DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and rdh1

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_932335.1 Gene:rdh1 / 378440 ZFINID:ZDB-GENE-030912-15 Length:327 Species:Danio rerio


Alignment Length:296 Identity:91/296 - (30%)
Similarity:154/296 - (52%) Gaps:31/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 WFALATVGAVLFYHFVKVS--ASG---KGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEES 133
            |.:||.:..:....|.:.|  .||   |.||||||::.....:|::||..||.|.|   ..:.|:
Zfish    13 WCSLAVIALIAAVWFFRDSRQISGIHEKHVLITGCDSGFGNLVARQLDRQGFLVIA---VCLTET 74

  Fly   134 DEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAH-WIALGELEWIP 197
            ..:| |:...|.|:|.|.|:||...:|..|..||.:..  |.:|||.:|:.|. .:.:|.::|:.
Zfish    75 GASK-LRATASPRLKTLQLNVTDSTSIDRALEYVRRET--GGKGLWGLVNNAGVSVPIGPMDWMQ 136

  Fly   198 FAVLRKSLDLNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACL 262
            ....:|.||:||.|...:|..||||:::|.||||.:.|.|.|: |.:.|..|.::..|:.|:..|
Zfish   137 LHDFKKVLDVNLTGVIAVTLKFLPLLKKAQGRVVNVASMLGRL-SIIGGGYCLSKFGVEAFSDSL 200

  Fly   263 RQEMRTRGVDVSVVAAGEFAPGNGWLNETE------LRDQAKQMWNQLSSEQKKTYGEDYYEAAM 321
            |::|...||.||::..|.|        :|:      :.|..|:.|:.|..:.::.||:.|.:..:
Zfish   201 RRDMVHFGVKVSIIEPGFF--------KTQVTDLGLIEDDLKKRWSNLPEQVRRDYGDSYLQEYL 257

  Fly   322 TSVEKYSRQ---AADIQPTLRVLIDAVTRTFPMARY 354
             .|:::|.:   ::|:......:..|::...|..||
Zfish   258 -KVQEFSMRMLASSDLSKVSSCMRHALSARHPRTRY 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 84/269 (31%)
adh_short 96..293 CDD:278532 70/203 (34%)
rdh1NP_932335.1 NADB_Rossmann 40..316 CDD:304358 84/269 (31%)
adh_short 40..224 CDD:278532 70/198 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4870
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48608
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm25684
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.