DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Rdh5

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_008763278.1 Gene:Rdh5 / 366791 RGDID:1308849 Length:318 Species:Rattus norvegicus


Alignment Length:298 Identity:89/298 - (29%)
Similarity:144/298 - (48%) Gaps:29/298 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VWFAL---ATVGAVLFYHFVKVSASGKG--VLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEE 132
            :|..|   |.:.|||:....:.|...:.  :.||||::.....||.:||..||.|.||..||...
  Rat     1 MWLPLLLGALLWAVLWLLRDRQSLPARDAVIFITGCDSGFGRLLALQLDQKGFQVLAGCLTPSGA 65

  Fly   133 SDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIA--LGELEW 195
            .|    |:::.|.|:....||:|..:.:.:.|::|...:  |..||:.:|:.| .:|  :|...|
  Rat    66 ED----LQQMASSRLHTTLLDITDPQNVQQVAKWVKTRV--GETGLFGLVNNA-GVAGIIGPTPW 123

  Fly   196 IPFAVLRKSLDLNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAA 260
            :.....::.|::|.||...:|...|||:::|.||||.:||.|.|:.:...| .|.::..::.|:.
  Rat   124 LTQDDFQRVLNVNTLGPIGVTLALLPLLQQARGRVVNITSVLGRIAANGGG-YCVSKFGLEAFSD 187

  Fly   261 CLRQEMRTRGVDVSVVAAGEF-APGNGWLNETELRDQAKQMWNQLSSEQKKTYGEDYYEAAMTSV 324
            .||::|...||.||:|..|.| .|..   |...|.:..|..|.:|....:..||    ||.:|:.
  Rat   188 SLRRDMAPFGVQVSIVEPGFFRTPVT---NLESLENTLKACWARLPPATQAHYG----EAFLTTY 245

  Fly   325 EKYSRQA------ADIQPTLRVLIDAVTRTFPMARYTP 356
            .:..|:.      .|:......|..|:|...|..||:|
  Rat   246 LQVQRRIMNLICDPDLTKVTSCLEHALTARHPRTRYSP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 82/272 (30%)
adh_short 96..293 CDD:278532 64/201 (32%)
Rdh5XP_008763278.1 NADB_Rossmann 31..306 CDD:419666 82/268 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5601
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48608
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm45679
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.