DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Kdsr

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_038946804.1 Gene:Kdsr / 360833 RGDID:1307775 Length:367 Species:Rattus norvegicus


Alignment Length:256 Identity:54/256 - (21%)
Similarity:106/256 - (41%) Gaps:45/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ALATVGAVLFYHFVK-------VSASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEES 133
            |...|..||..:.|.       ::..|..|::||..:.:...:|.:....|     .|.|.:..:
  Rat     6 AAGLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQG-----AFITLVARN 65

  Fly   134 DEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQH-------LPHGAEGLWSV---VHCAHWI 188
            :: |:|:    .:.::....:..::.:|..:..|||.       :....|.|..|   |:||...
  Rat    66 ED-KLLQ----AKKEIEKYSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTS 125

  Fly   189 ALGELEWIPFAVLRKSLDLNLLGSARLTQ-IFLPLVRRAHGRVVFLTSGLNRVPSPVRGI----- 247
            ..|:.|.:..:...|.:.:|.|||...:: :...:..|..||:||::|...::     |:     
  Rat   126 KSGKFEELEVSSFEKLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQL-----GLFGFTA 185

  Fly   248 QCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEF-APGNGWLNETELRDQAKQMWNQLSSE 307
            ..:::.|:...|..|:.|::...|.|:|....:. .||....|:|      |.:..:|.||
  Rat   186 YSSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKT------KPLETRLISE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 48/229 (21%)
adh_short 96..293 CDD:278532 44/213 (21%)
KdsrXP_038946804.1 KDSR-like_SDR_c 32..258 CDD:187643 49/230 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.