DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and CG30491

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:197 Identity:43/197 - (21%)
Similarity:77/197 - (39%) Gaps:35/197 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 STFAVFVWFALATVGAVLFY-------HFVK-VSASGKGVLITGCEAPLAWYLAKKLDDLGFTVY 123
            |..|.::.|...|.|...|.       .|.| .:.:||..::||....:.....:::...|.|||
  Fly     9 SRTAFWLSFTGTTTGLAFFVKDLMQGGQFTKETNETGKVFIVTGANTGIGKETVREIAKRGGTVY 73

  Fly   124 AGFNTPIEESDEAK--ILKEVTSGRMKLLHLDVTSEKTI---LEAARYVSQHLPHGAEGLWSVVH 183
            ..... :::.:||:  |:.|..:..:.....|:.|:::|   :.|.:...:|| |.......|:.
  Fly    74 MACRN-LKKCEEAREEIVLETKNKYVYCRQCDLASQESIRHFVAAFKREQEHL-HVLINNAGVMR 136

  Fly   184 CAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVRR------------AHGRVVFLTSG 236
            |...:....:|        ..|.:|.:|...||.:.|.|:::            ||.|....|..
  Fly   137 CPRSLTSDGIE--------LQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNVSSLAHTRGEINTGD 193

  Fly   237 LN 238
            ||
  Fly   194 LN 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 34/160 (21%)
adh_short 96..293 CDD:278532 34/160 (21%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 35/163 (21%)
NADB_Rossmann 45..319 CDD:304358 35/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.