DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and CG13284

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:89/252 - (35%) Gaps:66/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FVW---------FALATVGAVLFYHFVKVSASGKGVLITGCEAPLAWYLAKKL-DDLG-FTVYAG 125
            |:|         ..|.|:|..|:.:...:.:..|.||    |.....:|.:.| |..| :.|..|
  Fly    17 FIWQLISAAIYLVGLLTIGVFLYDNLKSLVSIIKAVL----EPYFQPHLPRTLVDKFGQWAVVTG 77

  Fly   126 FNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIAL 190
            ....|.:    :..:|:....:.|:.:..|.||.|.......||:...           ..|||.
  Fly    78 ATDGIGK----EYARELARQGINLVLISRTKEKLIAVTNEIESQYKVK-----------TKWIAA 127

  Fly   191 G-------------ELEWIPFAVL----------RKSLDL-------NLL----GS-ARLTQIFL 220
            .             ||..|...:|          .:||||       |||    || ..||:..|
  Fly   128 DFAKGREVYDQIEKELAGIDVGILVNNVGMMYEHPESLDLVSEDLLWNLLTVNMGSVTMLTRKIL 192

  Fly   221 P-LVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVV 276
            | ::.|..|.:|.|.|.....|.|...:..|::..|..|:..|..|:....:.|.:|
  Fly   193 PQMIGRRKGAIVNLGSSSELQPLPNMTVYAASKKFVTYFSKALELEVAEHNIHVQLV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 53/219 (24%)
adh_short 96..293 CDD:278532 53/219 (24%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 46/195 (24%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 46/195 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.