DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and CG15629

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:225 Identity:45/225 - (20%)
Similarity:89/225 - (39%) Gaps:51/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VWFALATV-GAVLFYHFVKV-SASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDE 135
            |::.|.:: .::|...|.|: ..||:.|||||....:...:|.....|                :
  Fly    32 VYYVLESIYYSLLPQRFRKLKDISGQVVLITGGGGGVGRLIALNFARL----------------Q 80

  Fly   136 AKIL-----KEVTSGRMKLL--H---------LDVTSEKTILEAARYVSQH------LPHGAEGL 178
            |:|:     :|.....:.||  |         :|::..:.|.:.|..|::.      |.:.|   
  Fly    81 ARIVIWDINQEAIKTTVDLLAKHGYDNCKGYVVDISDREQIYQRASQVTEEVGPVDILINNA--- 142

  Fly   179 WSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFLTSGLNRVPS 242
             .:|.|..:..|.:      .|::.:.::|::......:.||| ::|...|.:|.:.|....:.:
  Fly   143 -GIVCCKPFWELHD------RVIQNTYNINIISHYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGT 200

  Fly   243 PVRGIQCATQAAVDCFAACLRQEMRTRGVD 272
            .......||:.|...|...|..:::..|.|
  Fly   201 YGCSDYAATKYACIGFHESLLTDLKAHGYD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 38/200 (19%)
adh_short 96..293 CDD:278532 38/200 (19%)
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 38/199 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.