DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Mfe2

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:184 Identity:34/184 - (18%)
Similarity:71/184 - (38%) Gaps:74/184 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KVSASGKGVLITGCEAPL----AWYLAKK-----LDDLGFT------------------------ 121
            |:...|:..::||..|.|    |...|::     ::|||.|                        
  Fly     7 KLRYDGRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGE 71

  Fly   122 VYAGFNTPIEESDEAKILKEVTS--GRMKLL--HLDVTSEKTILEAARYVSQHLPHGAEGLWSVV 182
            ..|.:|:.|   |.||:::....  ||:.:|  :..:..::::::.           :|..|::|
  Fly    72 AVADYNSVI---DGAKVIETAIKAFGRVDILVNNAGILRDRSLVKT-----------SEQDWNLV 122

  Fly   183 HCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVRRA-HGRVVFLTS 235
            :                      |::|.||.:.||...|.:::. :||::..:|
  Fly   123 N----------------------DVHLKGSFKCTQAAFPYMKKQNYGRIIMTSS 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 32/178 (18%)
adh_short 96..293 CDD:278532 32/178 (18%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 33/183 (18%)
PRK07791 11..248 CDD:236099 33/180 (18%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.