DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and CG31810

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:233 Identity:45/233 - (19%)
Similarity:71/233 - (30%) Gaps:64/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAK------------------ILKE 141
            |...::||....:....|::|      ...|.|..:....|.|                  |:.:
  Fly    56 GNWAVVTGATDGIGKEYAREL------ARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVAD 114

  Fly   142 VTSGRMKLLHLDVTSEKTILEAARYVSQ----HLPHGAEG-----LWSVVHCAHWIALGELEWIP 197
            ...||....|::  .|...:|....|:.    |.|...:.     ||.:                
  Fly   115 FAKGREVYAHIE--KELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDL---------------- 161

  Fly   198 FAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAAC 261
                   |.:|:.....||:..|| ::.|..|.:|.|.|.....|.|......||:..|..|...
  Fly   162 -------LTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKG 219

  Fly   262 LRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAKQ 299
            |..|:....:.|.:|.....|     .|.....|:.:|
  Fly   220 LEYEVAEHNIHVQLVMPAFVA-----TNMNSYSDKVRQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 44/232 (19%)
adh_short 96..293 CDD:278532 42/224 (19%)
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 45/233 (19%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 45/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.