DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Ldsdh1

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster


Alignment Length:226 Identity:58/226 - (25%)
Similarity:92/226 - (40%) Gaps:42/226 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ISSISTFAVFVWFALATVGAVLFYHFVKVSASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFN 127
            :..|....|..|.|:|.....||........:||.|||||....:...:|.:...||.|:..   
  Fly    26 VVDIVMLIVKFWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILC--- 87

  Fly   128 TPIEESDEAKILKEVTSGRMKLLH--LDVTSEKTILEAARYVSQHLPHGAEGLWSVVH------- 183
            ..:.|....:.:||:.:...|...  .:||..:.::|.|:.|.:.  ||      .:|       
  Fly    88 WDVNEQTNNQTVKEIKNNGGKAFGYVCNVTKREELIELAQKVRKE--HG------FIHVVVNNAG 144

  Fly   184 ---CAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFLTS-----GL-N 238
               |...:...|.|      :|...::|:|....:.|.||| ::.|..|.:|.|:|     || |
  Fly   145 IMPCHPLLEHTENE------IRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLIN 203

  Fly   239 RVPSPVRGIQCATQAAVDCFAACLRQEMRTR 269
            .||      .|.|:.||..:.|.|.:|:|.:
  Fly   204 LVP------YCGTKFAVRGYMAALVEELRQK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 50/193 (26%)
adh_short 96..293 CDD:278532 50/193 (26%)
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 50/193 (26%)
NADB_Rossmann 60..287 CDD:304358 49/192 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.