DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and spidey

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster


Alignment Length:345 Identity:79/345 - (22%)
Similarity:134/345 - (38%) Gaps:77/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LLHALDISSISTFAVF----VWFALATVGAVLFYHFVKVSASGKGVLITGCEAPLAWYLAKKLDD 117
            ||..|.|..:. |.||    .|.....||..:|...|.:|..|:..::||....:....||:|..
  Fly    11 LLGGLAIGIVG-FQVFRKVLPWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTDGIGKAYAKELAR 74

  Fly   118 LGFTVYAGFNTPIEESDE-----AKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEG 177
            .|..:..     |..|.|     ||.:.:.....::::.:|.|....|.:..|..:..|..|   
  Fly    75 RGLKLVL-----ISRSLEKLNVVAKEIGDKYGVEVRVIDVDFTGGDEIYDKIREKTTGLNVG--- 131

  Fly   178 LWSVVHCAHWIALGELEWI--------PFAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFL 233
               |:.....|:.|..|:.        ||  ||..:..|:.....:|.:||| ::.:..|.::.:
  Fly   132 ---VLVNNVGISYGHPEYFLDCYKADPPF--LRNIVAANIHSVTHMTALFLPGMISQRRGVIINV 191

  Fly   234 TSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAK 298
            :|....:|:|:..:..:|:|.|:.|:..|:.|.:..|:.:..|..|..|     .|.:::|..: 
  Fly   192 SSTAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQPGFVA-----TNMSKIRKAS- 250

  Fly   299 QMWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQAADIQPTLRVLIDAVTRTFPMARYTPVTSSERL 363
                                ....|.|.|.|.|..   ||.:    .|:|   |.|.|   ...|
  Fly   251 --------------------VFAPSPETYVRSALS---TLGI----ATQT---AGYLP---HALL 282

  Fly   364 QIFLAEHLAPSLYESLYGEQ 383
            |:.:  |..    |:::|||
  Fly   283 QLVI--HFT----EAVFGEQ 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 62/297 (21%)
adh_short 96..293 CDD:278532 45/210 (21%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 79/345 (23%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 61/289 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.