DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and CG3603

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster


Alignment Length:191 Identity:43/191 - (22%)
Similarity:86/191 - (45%) Gaps:13/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEA--KILKEVTSGRMKLLHLDVTS 156
            :||..|:||..:.:.....:.|...|..|.|     ::.:.:|  :.::|:.|.|...|.:||:|
  Fly     7 AGKVALVTGAGSGIGRATCRLLARDGAKVIA-----VDRNLKAAQETVQELGSERSAALEVDVSS 66

  Fly   157 EKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLP 221
            .:::..:   |::.|....:....||:.|.....|.|..:|.........:||.|:..:||.:..
  Fly    67 AQSVQFS---VAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAK 128

  Fly   222 LV---RRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAG 279
            .:   :..:|.:|.|:|.:.::.:..:....||:|.|..|.....:|....|:.|:.:..|
  Fly   129 AMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 42/189 (22%)
adh_short 96..293 CDD:278532 42/189 (22%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 43/191 (23%)
BKR_SDR_c 9..248 CDD:187594 42/189 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.