DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Dhrs7l1

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001013116.1 Gene:Dhrs7l1 / 299131 RGDID:1308036 Length:324 Species:Rattus norvegicus


Alignment Length:259 Identity:61/259 - (23%)
Similarity:104/259 - (40%) Gaps:44/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FERLFMPFLFCQAAAIVTSHLLHALDISSISTFAVFVWFALATVGAVLFYHFVKVSASGKGVLIT 101
            ||  |.....| |..::...||..|.:.|..|.....|.......|:          :.|.|.||
  Rat     4 FE--FWMLALC-ALLLLVLGLLSFLWLDSDLTLLRAAWMGQCPEQAL----------ADKVVWIT 55

  Fly   102 GCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKILKE--VTSGRMK-----LLHLDVT---- 155
            |..:.:...||.:|..||..:...    .....|.:.:|.  :.:|.:|     :|.||:.    
  Rat    56 GASSGIGEELAFQLSKLGVCLVLS----ARRGQELERVKRRCLENGNLKEKDILVLPLDLADTSS 116

  Fly   156 ---SEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQ 217
               :.||:|:....:...:.:|.        .||...:.......|.||   :::|.||:..||:
  Rat   117 HDIATKTVLQEFGRIDILVNNGG--------VAHASLVENTNMDIFKVL---IEVNYLGTVSLTK 170

  Fly   218 IFLP-LVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEM-RTRGVDVSVVAAG 279
            ..|| ::.|..|::|.:.|.:..||.|:.....|::.|:..|...||.|: ...|:.:|::..|
  Rat   171 CVLPHMMERNQGKIVVMKSLVGIVPRPLCSGYAASKLALRGFFDVLRTELFDYPGITLSMICPG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 49/200 (25%)
adh_short 96..293 CDD:278532 49/200 (25%)
Dhrs7l1NP_001013116.1 11beta-HSD1_like_SDR_c 47..305 CDD:187593 49/213 (23%)
adh_short 50..247 CDD:278532 49/200 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.