DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Hsd17b1

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_036983.1 Gene:Hsd17b1 / 25322 RGDID:2836 Length:344 Species:Rattus norvegicus


Alignment Length:276 Identity:76/276 - (27%)
Similarity:116/276 - (42%) Gaps:37/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VLITGCEAPLAWYLAKKL---DDLGFTVYAGFNT-----PIEESDEAKILKEVTSGRMKLLHLDV 154
            ||||||.:.:..:||.:|   ....|.|||....     |:.|:..|   :....|.:::|.|||
  Rat     6 VLITGCSSGIGLHLAVRLASDRSQSFKVYATLRDLKSQGPLLEAARA---QGCPPGSLEILELDV 67

  Fly   155 TSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIAL-GELEWIPFAVLRKSLDLNLLGSARLTQI 218
            ...:::..|...|:       ||...|:.|.....| |.||......:...||:|:||:.|:.|.
  Rat    68 RDSESVAAARACVT-------EGRVDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQA 125

  Fly   219 FLPLVRRAH-GRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAG--- 279
            |||.::|.| |||:...|....:..|...:.||::.|::.....|...:...||.||::..|   
  Rat   126 FLPDMKRRHSGRVLVTASVGGLMGLPFHEVYCASKFALEGLCESLAILLPLFGVHVSLIECGAVH 190

  Fly   280 -------EFAPGNGWLNETELRDQAKQMWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQAADIQPT 337
                   |..|| |.|...:.:.:......|...||..:..:|..|.    .|.:.......||.
  Rat   191 TAFHEKLEGGPG-GALERADAQTRHLFAHYQRGYEQALSEAQDPEEV----TELFLTAMRAPQPA 250

  Fly   338 LRVLIDAVTRTFPMAR 353
            ||..  :..|..|:||
  Rat   251 LRYF--STNRFLPLAR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 76/276 (28%)
adh_short 96..293 CDD:278532 62/214 (29%)
Hsd17b1NP_036983.1 NADB_Rossmann 4..260 CDD:419666 73/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.