DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and CG30495

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster


Alignment Length:303 Identity:63/303 - (20%)
Similarity:117/303 - (38%) Gaps:70/303 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VWFALATVGAVLFY--------HFVK-VSASGKGVLITGCEAPLAWYLAKKLDDLGFTVY-AGFN 127
            |:.|...||.:.|.        .|.| ...:||..::||....|......:|...|.||| |..|
  Fly    14 VFLAHGIVGIIAFCVRLYMQGGKFRKQTDETGKVAIVTGGNTGLGKETVMELARRGATVYMACRN 78

  Fly   128 TPIEESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGE 192
            ....|....:|:||..:..:.....|::|    |::.|..:::.......|..:::.|      .
  Fly    79 KEKVERARREIVKETGNSNVFSRECDLSS----LDSIRKFAENFKKEQRVLHILINNA------G 133

  Fly   193 LEWIPFAVLRKSLDLNL----LGSARLTQIFLPLVRR-AHGRVVFLTS-----------GLNRVP 241
            :.|.|..:.::..:::|    :|...||.:.|.::.| |..|||.:.|           .:|...
  Fly   134 VFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDDINSSD 198

  Fly   242 SPVRGI-QCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAKQMWNQLS 305
            ....|: .|.::.|...|...|.:.:...||.|:.:..|        :.:||:   |:.|     
  Fly   199 FYDEGVAYCQSKLANILFTRELAKRLEGTGVTVNALNPG--------IADTEI---ARNM----- 247

  Fly   306 SEQKKTYGEDYYEAAMTSVEKYSRQAADIQPTLRVLIDAVTRT 348
                     .:::.      |:::..  ::..||.|:.||.:|
  Fly   248 ---------IFFQT------KFAQYV--VETILRPLLWAVMKT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 55/271 (20%)
adh_short 96..293 CDD:278532 45/214 (21%)
CG30495NP_001260785.1 FabG 44..296 CDD:223959 56/273 (21%)
NADB_Rossmann 45..323 CDD:304358 56/272 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.