DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_663403.1 Gene:Dhrs7b / 216820 MGIID:2384931 Length:323 Species:Mus musculus


Alignment Length:336 Identity:72/336 - (21%)
Similarity:120/336 - (35%) Gaps:65/336 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LDISSISTFAVFVWFALATVGAVLFYHFVKVSASGKG--VLITGCEAPLAWYLAKKLDDLGF-TV 122
            :|::|.:|....::..|...........::..|..:.  |::||..:.|....||.....|. .|
Mouse    16 MDLASQTTILPLLFGCLGIFSLFRLLQRIRSKAYLRNAVVVVTGATSGLGRECAKVFHAAGAKLV 80

  Fly   123 YAGFNTPIEESDEAKILKEVTSGRMKLLH------LDVTSEKTILEAARYVSQHLPHGAEGLWSV 181
            ..|.|....|    ::.:|:........|      .|:....||..||          ||    :
Mouse    81 LCGRNVKALE----ELSRELAGSSQGQTHQPFVVTFDLADPGTIAAAA----------AE----I 127

  Fly   182 VHCAHWIAL----------GELEWIPFAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFLTS 235
            :.|..::.:          |.:......|.||.:::|..|...||:..|| :|.|..|.:|.::|
Mouse   128 LQCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKQGHIVAISS 192

  Fly   236 GLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAKQM 300
            ...::..|.|....|::.|...|..|||.||....:.|:|::.|                   .:
Mouse   193 IQGKISIPFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPG-------------------YI 238

  Fly   301 WNQLSSEQKKTYGEDYYEAAMTSVEKYSRQAADIQPTLRVLIDAVTRTFPMARYTPVTSSERLQI 365
            ...||.......|..|  .|:.......|.||::   .:.:.|||.:.......|....|..:.|
Mouse   239 HTNLSVNAVTADGSRY--GALDKNTAQGRSAAEV---AQDVFDAVGKKKKDVLLTDFVPSMAVYI 298

  Fly   366 FLAEHLAPSLY 376
               ..|||.|:
Mouse   299 ---RTLAPGLF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 67/301 (22%)
adh_short 96..293 CDD:278532 49/216 (23%)
Dhrs7bNP_663403.1 11beta-HSD1_like_SDR_c 50..309 CDD:187593 67/302 (22%)
PRK06181 52..319 CDD:235726 67/300 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.