DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Rdh16f2

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_663399.2 Gene:Rdh16f2 / 216454 MGIID:3583955 Length:318 Species:Mus musculus


Alignment Length:317 Identity:95/317 - (29%)
Similarity:154/317 - (48%) Gaps:29/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VW-FALATVGAVLFYHF-----VKVSASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIE 131
            :| :.:|.:|..:...|     |......|.|.||||.:.....||::||..|..|.|.    ..
Mouse     1 MWLYMVALLGLWMLLRFFRERQVVDHLQDKYVFITGCGSGFGNLLARQLDRRGMRVLAA----CR 61

  Fly   132 ESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAH-WIALGELEW 195
            :.:.|:.|:..||.|::.:.||||..:.|:.|.::|.:.:  |..|||.:|:.|. .:..|..||
Mouse    62 KEEGAEELRRKTSERLETVILDVTKTENIVAATQWVKERV--GNRGLWGLVNNAGISVPSGPNEW 124

  Fly   196 IPFAVLRKSLDLNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAA 260
            :........||:||||...:|...|||||:|.||||.::|.|.||.....|..|.::..::.|:.
Mouse   125 MKKQDFASVLDVNLLGLIEVTLSMLPLVRKARGRVVNVSSILGRVSLGGSGGYCISKYGIEAFSD 189

  Fly   261 CLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAKQMWNQLSSEQKKTYGEDYYEAAMTSVE 325
            .||:|:|..||.|:::..|.|.  .|..:...|....:.:|:|.|||.::.|||.|..:.:.::.
Mouse   190 SLRRELRYFGVKVAIIEPGFFL--TGMASSARLCSNIQMLWDQTSSEIREIYGEKYLASYLKNLN 252

  Fly   326 KYSRQA-ADIQPTLRVLIDAVTRTFPMARY----------TPVTSSERLQIFLAEHL 371
            :..::. .|:......:..|:|...|..||          ||::   .|..||.:.|
Mouse   253 ELDQRCNKDLSVVTDCMEHALTACHPRTRYSAGWDAKLFFTPLS---YLPTFLVDAL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 90/288 (31%)
adh_short 96..293 CDD:278532 68/197 (35%)
Rdh16f2NP_663399.2 type2_17beta_HSD-like_SDR_c 30..307 CDD:187665 90/288 (31%)
adh_short 30..219 CDD:278532 68/196 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5728
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4195
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48608
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm43606
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.