DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and C55A6.7

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_505924.1 Gene:C55A6.7 / 183836 WormBaseID:WBGene00008336 Length:251 Species:Caenorhabditis elegans


Alignment Length:272 Identity:63/272 - (23%)
Similarity:110/272 - (40%) Gaps:65/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SGKGVLITGCEAPLAWYLAKK-LDDLGFT-VYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTS 156
            |.|.|::||....|.:.|.:: |.|.... |.|    ...:.|:|..||.:...|:.:|.|.:.|
 Worm     2 SPKSVVVTGSNRGLGFGLVQQFLKDPNVQHVIA----TARDVDKATALKGICDPRLHILQLSLGS 62

  Fly   157 EKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKS-----LDL---NLLGSA 213
            :::|...|..||:.:  |..||..:::.|       ...:|:...:|.     |||   |.:|..
 Worm    63 DESIANFAEKVSEIV--GESGLTLLINNA-------AVMLPYVTKQKPDRKVVLDLFESNTIGPM 118

  Fly   214 RLTQIFLPLVRRA------------HGRVV-----FL------TSGLNRVPSPVRGIQCATQAAV 255
            .|||..:||:.:|            .|.::     ||      |||.....:....:   |:.||
 Worm   119 MLTQSLVPLIIKASKRQEGDTLSVSRGAIINIASEFLGSISENTSGSGEYKAMAYRM---TKCAV 180

  Fly   256 DCFAACLRQEMRTRGVDVSVVAAG--------EFAPGNGWLNETELRDQAKQMWNQLSSEQKKTY 312
            :.|...|..:::    |..::.||        :.:.|.|.|...|...|....:|:|.:    |:
 Worm   181 NQFTKTLSIDLK----DDHILTAGICPGMVQTDMSKGKGQLTIEESSSQILAAFNKLGA----TH 237

  Fly   313 GEDYYEAAMTSV 324
            ...|:...::.:
 Worm   238 NGGYFRRDLSII 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 62/270 (23%)
adh_short 96..293 CDD:278532 56/237 (24%)
C55A6.7NP_505924.1 adh_short 4..216 CDD:278532 54/231 (23%)
carb_red_sniffer_like_SDR_c 6..250 CDD:187586 61/268 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.