DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and C55A6.4

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_505922.1 Gene:C55A6.4 / 183833 WormBaseID:WBGene00008333 Length:250 Species:Caenorhabditis elegans


Alignment Length:221 Identity:49/221 - (22%)
Similarity:92/221 - (41%) Gaps:43/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SGKGVLITGCEAPLAWYLAKK-LDDLGFTVYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSE 157
            |.|.|:|||....:...|.:: :.|............:|::.:   ||.::..|:..|.|:||.:
 Worm     2 SPKSVVITGANRGIGLGLVQEFVKDKNIRHIIATARDVEKATD---LKAISDPRVTALQLEVTCD 63

  Fly   158 KTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPF------AVLRKSLDLNLLGSARLT 216
            |::......|.:.:  |::||..:|:.|     |.....|.      |:..:.|::|......||
 Worm    64 KSMDTFVSKVEEIV--GSDGLNLLVNNA-----GNAVDYPCKAKPNRALFAEQLNVNTTSVVILT 121

  Fly   217 QIFLPLVRRAHGR------------VVFLTSGLNRVPSPVRGIQC-------ATQAAVDCFAACL 262
            |..:||:.:|..:            ||.::|||..:.....|...       .::||::.|...|
 Worm   122 QKLMPLLIKASSKVSGDQLSASRAAVVTISSGLASMTDFATGGHAPNAFAYRISKAAINMFGRAL 186

  Fly   263 RQEMRTRGVDVSVVAAGEFAPGNGWL 288
            ..:|:...:.|:.:       |.||:
 Worm   187 ANDMKDDHILVASI-------GPGWV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 48/219 (22%)
adh_short 96..293 CDD:278532 48/219 (22%)
C55A6.4NP_505922.1 adh_short 4..213 CDD:278532 48/219 (22%)
carb_red_sniffer_like_SDR_c 6..250 CDD:187586 47/217 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.