DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and dhs-29

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_509294.1 Gene:dhs-29 / 181027 WormBaseID:WBGene00000992 Length:427 Species:Caenorhabditis elegans


Alignment Length:289 Identity:58/289 - (20%)
Similarity:110/289 - (38%) Gaps:60/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FAVFVWFALATVGAVLFYHFVKV-------------SASGKGVLITGCEAPLAWYLAKKLDDLGF 120
            :..:.|...:|:|..|...|:.:             |..|:.|:|||..:.|...:|     |.|
 Worm     2 YTSWAWKLWSTLGVALRILFIDIPMDIHRFLNLRQKSVQGQTVIITGGGSGLGRAMA-----LDF 61

  Fly   121 TVYAGFNTPIEESDEA--KILKEVTS-GRM-KLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSV 181
            .........|:.:.|.  :.:|.:.: |.| |..:.|::....:.:.|:.:....     |..::
 Worm    62 AKRKAKVAIIDVNKEGGLETVKTIAAEGNMAKFWYCDISDVDNMKKTAKEIEDTF-----GDVNI 121

  Fly   182 VHC-AHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFL---------TS 235
            |.| |..::......|...:|||.||:|:.|:....:.||| :..:..|.:|.:         |.
 Worm   122 VICNAAILSFTSFMEISDELLRKCLDVNIFGTINTIRAFLPKMETKNDGHIVCVCSIAGWSGETM 186

  Fly   236 GLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVD-------------VSVVAAGEFAPGNGW 287
            ||:         .|.::.||......|:.|:|.||::             ..::......|...|
 Worm   187 GLS---------YCTSKFAVRGAMESLQMELRDRGLEGIKTTTLYPYFARTPMILENNMRPTCTW 242

  Fly   288 LNETELRDQAKQMWNQLSSEQKKTYGEDY 316
            .....:|..:|:|.:.:..|:...:...|
 Worm   243 FPFMSIRSCSKRMVDSILKEKVHAFVPSY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 51/249 (20%)
adh_short 96..293 CDD:278532 46/224 (21%)
dhs-29NP_509294.1 adh_short 42..230 CDD:278532 44/206 (21%)
NADB_Rossmann 43..281 CDD:304358 51/248 (21%)
DUF4499 322..416 CDD:291595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.