DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and C30G12.2

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_495520.2 Gene:C30G12.2 / 174195 WormBaseID:WBGene00016274 Length:276 Species:Caenorhabditis elegans


Alignment Length:226 Identity:54/226 - (23%)
Similarity:95/226 - (42%) Gaps:56/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPI------EESDEAKILKEVTSGRMKLLHLDV 154
            |.::|||....:.:.|.|.     |..|.|....|      |::||...||  ...|:.::.|:|
 Worm    29 KNIMITGANRGIGFGLVKH-----FLEYDGIELLIATCRNPEKADELNALK--NDRRLHVIALNV 86

  Fly   155 TSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAV---------LRKSLDLNLL 210
            ..:::|.:....||..:  .:.||..:::.|     |.|  :|:.|         :.|.|:.|.:
 Worm    87 DDDESIKKVFDEVSSLV--SSNGLNMLINNA-----GIL--LPYEVDGPKICRKTMMKQLETNSV 142

  Fly   211 GSARLTQIFLPLVRRAHGRVVFLTSGLNR-----VPSPVRGIQ----C---------ATQAAVDC 257
            ..|.||||||||::.|........:.::|     :.|.:..|:    |         .:::|::.
 Worm   143 SVAILTQIFLPLIKTAASAAEGDEASIDRASIINISSTMASIEMNNGCFDGPMTAYRMSKSALNA 207

  Fly   258 FAACLRQEMRTRGVDVSVVAAGEFAPGNGWL 288
            ||.....|:....:.|:     .|.|  ||:
 Worm   208 FARQSFMELSKYHILVT-----SFCP--GWV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 54/226 (24%)
adh_short 96..293 CDD:278532 54/226 (24%)
C30G12.2NP_495520.2 carb_red_sniffer_like_SDR_c 31..268 CDD:187586 53/224 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.