DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and dhs-4

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_492563.1 Gene:dhs-4 / 172810 WormBaseID:WBGene00000968 Length:305 Species:Caenorhabditis elegans


Alignment Length:217 Identity:43/217 - (19%)
Similarity:79/217 - (36%) Gaps:73/217 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAK----------------------- 137
            |.|||||....|...||:|....|.|:.. ::..::..||.|                       
 Worm    41 KKVLITGAGNGLGKLLAQKFAARGATLIL-WDINLQSVDELKNEIRGNQGEAHSYEVNLCDPGKI 104

  Fly   138 ------ILKEVTSGRMKLL--HLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELE 194
                  ::.::  |::.:|  :..:.:.|.||:::                           |.|
 Worm   105 AQVGQQVINDI--GKVDILVNNAGIATAKMILDSS---------------------------ENE 140

  Fly   195 WIPFAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFLTSGLNRVPSPVRGIQCATQ-AAV-- 255
                  :.:|.|:|:.......|.||| :::..:|.:|.:.|...::.|.......:|: |||  
 Worm   141 ------INRSFDVNVKAHFYTVQQFLPAMLKDNNGHIVTIASAAGKMGSSGLADYSSTKHAAVGF 199

  Fly   256 -DCFAACLRQEMRTRGVDVSVV 276
             |...|.: .|....||..::|
 Worm   200 HDSLVAEI-MESEKNGVKTTLV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 43/217 (20%)
adh_short 96..293 CDD:278532 43/217 (20%)
dhs-4NP_492563.1 adh_short 41..235 CDD:278532 43/217 (20%)
17beta-HSDXI-like_SDR_c 43..286 CDD:187598 42/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.