DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Dhrs9

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_570832.1 Gene:Dhrs9 / 170635 RGDID:620655 Length:319 Species:Rattus norvegicus


Alignment Length:308 Identity:92/308 - (29%)
Similarity:148/308 - (48%) Gaps:46/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTI 160
            |.:.||||::......|:..|..||.|.|...|  |...||  ||..||.|:..:.||||:.:.:
  Rat    30 KYIFITGCDSGFGNLAARTFDRKGFRVIAACLT--ESGSEA--LKAKTSERLHTVLLDVTNPENV 90

  Fly   161 LEAARYVSQHLPHGAEGLWSVVHCAHWI-ALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVR 224
            .|.|::|..|:  |.:|||.:::.|..: .|...:|:.....|:.:::||.|...:|...||||:
  Rat    91 KETAQWVKSHV--GEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVK 153

  Fly   225 RAHGRVVFLTS--------GLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEF 281
            :|.|||:.::|        |....||         :.||:.|...||::|:..||.||.:..|.|
  Rat   154 KARGRVINVSSIGGRLAFGGGGYTPS---------KYAVEGFNDSLRRDMKAFGVHVSCIEPGLF 209

  Fly   282 APGNGWLNETELRDQAK------QMWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQAADIQPTLRV 340
                    :|.|.|..|      .:|..||.:.|:.|||.|.|   .|:.:.....:.:...|.:
  Rat   210 --------KTGLADPIKTTEKKLAIWKHLSPDIKQQYGEGYIE---KSLHRLKSSTSSVNLDLSL 263

  Fly   341 LID----AVTRTFPMARYTPVTSSERLQIFLAEHLAPSLYESLYGEQK 384
            :::    |:|..||..|||....::...|.|: |:..:|.:.|..::|
  Rat   264 VVECMDHALTSLFPKTRYTAGKDAKTFWIPLS-HMPAALQDFLLLKEK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 90/302 (30%)
adh_short 96..293 CDD:278532 65/205 (32%)
Dhrs9NP_570832.1 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 90/302 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5601
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48608
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm45679
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.