DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and T25G12.13

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001257285.1 Gene:T25G12.13 / 13224720 WormBaseID:WBGene00219274 Length:310 Species:Caenorhabditis elegans


Alignment Length:328 Identity:74/328 - (22%)
Similarity:127/328 - (38%) Gaps:62/328 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ISTFAVFVWFAL---ATVGAVLFYHFVKVSASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFN 127
            :.|..:::.:.|   |..||   ::..|::...|.|:|||..:.|...||.:|...|..|..   
 Worm    17 VVTICLYLAYNLLNKAIPGA---HNLSKLNVKNKIVVITGASSGLGKSLAFELYKRGAQVIL--- 75

  Fly   128 TPIEESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWS-------VVHCA 185
              :..|.|.  |||:.:...|...|:...       ..|....:.:..:..|:       :::.|
 Worm    76 --LARSTEK--LKEICAELTKTFPLNKNK-------PTYYFFDITNPDKAPWAQIPKVDVLINNA 129

  Fly   186 HWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCA 250
            .....|..:....|:.||:::.||.|..::||..|..: ...|.:|..:|...:|..|.||...|
 Worm   130 GMSNRGSCQDTTMAIHRKAMETNLFGHVQVTQSLLSKL-SPDGCIVVTSSIQGKVAIPYRGSYSA 193

  Fly   251 TQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAKQMWNQLSSEQKKTYGED 315
            ::.|:..:..|||.|  .:.:.:.||:||....|.|    :...|...::.......|||.|..:
 Worm   194 SKHALQGYFDCLRAE--HKNLHILVVSAGYINTGFG----SRALDTDGKVVGVEDENQKKGYSPE 252

  Fly   316 YYEAAMTSVEKYSRQAADIQPTLRVLIDAV---TRTFPMARYTPVTSSERLQIFLAEHLAPSLYE 377
            :                    :.|::.||:   ...|.||.:     ..|..|||.......|..
 Worm   253 H--------------------SARMISDAIRDRVSDFDMAPF-----GARFAIFLRYFWPTLLNY 292

  Fly   378 SLY 380
            :||
 Worm   293 ALY 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 66/293 (23%)
adh_short 96..293 CDD:278532 50/203 (25%)
T25G12.13NP_001257285.1 NADB_Rossmann 44..290 CDD:304358 65/291 (22%)
PRK06181 46..289 CDD:235726 65/288 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.