DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and SDR9C7

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_683695.1 Gene:SDR9C7 / 121214 HGNCID:29958 Length:313 Species:Homo sapiens


Alignment Length:285 Identity:90/285 - (31%)
Similarity:149/285 - (52%) Gaps:17/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEK 158
            |.|.|.||||::.....|||:|.|.|..|.|...|  ||..:.  |:..||.|::...||||..:
Human    24 SEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFT--EEGSQK--LQRDTSYRLQTTLLDVTKSE 84

  Fly   159 TILEAARYVSQHLPHGAEGLWSVVHCAH-WIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPL 222
            :|..||::|...:  |.:|||::|:.|. .:..|..||:......|.:::||:|...:|...||:
Human    85 SIKAAAQWVRDKV--GEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEVTLHMLPM 147

  Fly   223 VRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGW 287
            |:||.||||.::|...|| :.:.|..|.::..|:.|:..:|:|:...||.|.::..|.:.  ...
Human   148 VKRARGRVVNMSSSGGRV-AVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYR--TAI 209

  Fly   288 LNETELRDQAKQMWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQAADIQPTLRVLID----AVTRT 348
            |.:..|..:.:::|.:|..|.:.:|||||:......::...:.|   :|.:|.:|:    |:...
Human   210 LGKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVA---EPRVRDVINSMEHAIVSR 271

  Fly   349 FPMARYTPVTSSERLQIFLAEHLAP 373
            .|..||.|...::.|.|.||:...|
Human   272 SPRIRYNPGLDAKLLYIPLAKLPTP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 89/283 (31%)
adh_short 96..293 CDD:278532 66/197 (34%)
SDR9C7NP_683695.1 type2_17beta_HSD-like_SDR_c 26..302 CDD:187665 89/283 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5479
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48608
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm41558
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1882
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.