DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and Bdh1

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_446447.2 Gene:Bdh1 / 117099 RGDID:620131 Length:344 Species:Rattus norvegicus


Alignment Length:292 Identity:93/292 - (31%)
Similarity:157/292 - (53%) Gaps:5/292 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKI--LKEVTSGRMKLLHLDV 154
            :||||.||:|||::...:.|||.|...||.|:||  ..:::..:|.:  |..:.|.|::.:.|:|
  Rat    53 AASGKAVLVTGCDSGFGFSLAKHLHSKGFLVFAG--CLLKDKGDAGVRELDSLKSDRLRTIQLNV 115

  Fly   155 TSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIF 219
            .:.:.:.:|...|...|....:|:|.:|:.|.....||:|:......::..::||.|:.|.|:.|
  Rat   116 CNSEEVEKAVETVRSGLKDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSF 180

  Fly   220 LPLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPG 284
            |||:|||.||||.::|.|.|:.:|.|...|.|:..|:.|:.|||.||...||.||||..|.|...
  Rat   181 LPLLRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPGNFIAA 245

  Fly   285 NGWLNETELRDQAKQMWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQ-AADIQPTLRVLIDAVTRT 348
            ....:...::..||:||::|....:|.||:.|::..:..:|.|... :.|....:..:..|:|..
  Rat   246 TSLYSPERIQAIAKKMWDELPEVVRKDYGKKYFDEKIAKMETYCNSGSTDTSSVINAVTHALTAA 310

  Fly   349 FPMARYTPVTSSERLQIFLAEHLAPSLYESLY 380
            .|..||.|:.....|::.:..|...::.:.:|
  Rat   311 TPYTRYHPMDYYWWLRMQVMTHFPGAISDKIY 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 89/286 (31%)
adh_short 96..293 CDD:278532 69/198 (35%)
Bdh1NP_446447.2 type2_17beta_HSD-like_SDR_c 57..342 CDD:187665 89/286 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5601
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4098
OMA 1 1.010 - - QHG48608
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm45679
orthoMCL 1 0.900 - - OOG6_109704
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.