DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and DHRS9

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001276692.1 Gene:DHRS9 / 10170 HGNCID:16888 Length:379 Species:Homo sapiens


Alignment Length:297 Identity:90/297 - (30%)
Similarity:146/297 - (49%) Gaps:24/297 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTI 160
            |.:.||||::......|:..|..||.|.|...|  |....|  ||..||.|::.:.||||..:.:
Human    90 KYIFITGCDSGFGNLAARTFDKKGFHVIAACLT--ESGSTA--LKAETSERLRTVLLDVTDPENV 150

  Fly   161 LEAARYVSQHLPHGAEGLWSVVHCAHWI-ALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVR 224
            ...|::|...:  |.:|||.:::.|... .|...:|:.....|:.:::||.|...:|...||||:
Human   151 KRTAQWVKNQV--GEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVK 213

  Fly   225 RAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLN 289
            :|.|||:.::|...|: :.|.|....::.||:.|...||::|:..||.||.:..|.|        
Human   214 KAQGRVINVSSVGGRL-AIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLF-------- 269

  Fly   290 ETELRDQAK------QMWNQLSSEQKKTYGEDYYEAAMTSVE-KYSRQAADIQPTLRVLIDAVTR 347
            :|.|.|..|      .:|.|||.:.|:.|||.|.|.::..:: ..|....|:.|.:..:..|:|.
Human   270 KTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTS 334

  Fly   348 TFPMARYTPVTSSERLQIFLAEHLAPSLYESLYGEQK 384
            .||...|.....::...|.|: |:..:|.:.|..:||
Human   335 LFPKTHYAAGKDAKIFWIPLS-HMPAALQDFLLLKQK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 87/291 (30%)
adh_short 96..293 CDD:278532 62/197 (31%)
DHRS9NP_001276692.1 type2_17beta_HSD-like_SDR_c 90..366 CDD:187665 87/291 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5479
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48608
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 1 1.000 - - otm41558
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.