DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and LOC100498221

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_002939751.1 Gene:LOC100498221 / 100498221 -ID:- Length:320 Species:Xenopus tropicalis


Alignment Length:266 Identity:77/266 - (28%)
Similarity:135/266 - (50%) Gaps:19/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTI 160
            |.||||||::....:|||.||..|..|.|...|    :..|:.||:..|.|::.:.||||..:::
 Frog    30 KYVLITGCDSGFGNHLAKSLDKQGMQVLAACLT----NTGAEALKKEASSRLQTVILDVTDSQSV 90

  Fly   161 LEAARYVSQHLPHGAEGLWSVVHCA-HWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVR 224
            ..|..:|:..:  |..|||.:|:.| ..|.....||:......|.|::||||:..:|...|||:|
 Frog    91 KSAVLWVTGIV--GDTGLWGLVNNAGTTIPSAPNEWLTKEDFWKVLNVNLLGTIDVTLALLPLIR 153

  Fly   225 RAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEF-APGNGWL 288
            ::.||::.::|.:.|: :.:.|....::..|:.|:..||:|::..||.|||:....: .|.    
 Frog   154 KSRGRIINMSSVMGRL-AFIGGGYSISRHGVEAFSDSLRRELQPFGVRVSVIEPTTYRTPA---- 213

  Fly   289 NETELR---DQAKQMWNQLSSEQKKTYGEDYY-EAAMTSVEKYSRQAADIQPTLRVLIDAVTRTF 349
              |:|:   :....:||:.....:.:||:.|: :.......|.|:....:......:..|:|..:
 Frog   214 --TDLKATLESIHAIWNKCPKHIQTSYGQQYFLDYCKIIRHKLSKCNPHVSQVTDCMEHALTAVY 276

  Fly   350 PMARYT 355
            |..||:
 Frog   277 PWTRYS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 77/266 (29%)
adh_short 96..293 CDD:278532 64/198 (32%)
LOC100498221XP_002939751.1 NADB_Rossmann 30..306 CDD:419666 77/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.