DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and dhrs7c

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_012826975.2 Gene:dhrs7c / 100135266 XenbaseID:XB-GENE-5956201 Length:704 Species:Xenopus tropicalis


Alignment Length:187 Identity:44/187 - (23%)
Similarity:72/187 - (38%) Gaps:39/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GELEWIPFAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAA 254
            |.|:.:...:.:|.:|.|..|...|.:..|| ::.|..|::|.:.:...::..|.|....|::.|
 Frog   133 GPLQSVSLELDKKIMDANYFGPITLVKAILPHMISRRTGQIVLVNTIQGKIGVPFRAAYAASKHA 197

  Fly   255 VDCFAACLRQEMRTRGVDVSVVAAG-------EFAPGNGWLNETELRDQAKQMWNQLSSEQKKTY 312
            :..|..|||.|:....|.||.|:..       :..||| |         ...:|..:        
 Frog   198 IQGFFDCLRAEVEEFDVSVSTVSPTFIRSYHVQPQPGN-W---------EASIWKWI-------- 244

  Fly   313 GEDYYEAAMTS----VEKYSRQAADIQPTLRVLIDAVTRTFPMARYTPVTSSERLQI 365
               :|..||.|    ..:....||...||..|...|      .|.:....:.|||::
 Frog   245 ---FYRVAMESPACVASRGQGTAAHGAPTCNVQEKA------NAIWKSCHACERLEV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 44/187 (24%)
adh_short 96..293 CDD:278532 29/109 (27%)
dhrs7cXP_012826975.2 11beta-HSD1_like_SDR_c 35..257 CDD:187593 34/144 (24%)
LAP2alpha 425..629 CDD:371604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.