DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8888 and rdh16

DIOPT Version :9

Sequence 1:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001107359.1 Gene:rdh16 / 100135184 XenbaseID:XB-GENE-1007896 Length:317 Species:Xenopus tropicalis


Alignment Length:301 Identity:95/301 - (31%)
Similarity:154/301 - (51%) Gaps:37/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VW-FALATVGAVLFYHF-----VKVSASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIE 131
            :| |.|..:..:|.|.:     :..:.:.|.|.||||::.....|||:||..|..|.|...|   
 Frog     1 MWLFLLVLLALILLYRWNIGRKMLPNLTDKYVFITGCDSGFGNLLAKQLDRRGLWVLAACLT--- 62

  Fly   132 ESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIA--LGELE 194
             ...|:.||:.||.|:|.:.|:||..::::.|:.:||..:  |.:|||.:|:.| .|:  :...|
 Frog    63 -DKGAEELKKETSSRLKTVILNVTDSQSVISASAWVSDIV--GNKGLWGLVNNA-GISNPIAPNE 123

  Fly   195 WIPFAVLRKSLDLNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFA 259
            |:......|.|::||||...:|...|||:|:|.||:|.:.|...|| |...|....::..|:.|:
 Frog   124 WLSKEDYLKVLNVNLLGVIDITLKLLPLIRKARGRIVNVASVAGRV-SLCGGGYSISKYGVESFS 187

  Fly   260 ACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRD---QAK---QMWNQLSSEQKKTYGEDYYE 318
            ..||:||...|:.||:|..|.|        :|.:.|   |.|   ::|.:|....::|||::|:|
 Frog   188 DSLRREMAQFGIKVSIVEPGYF--------KTPVADANTQKKFLNEIWAKLPQHIRETYGQEYFE 244

  Fly   319 AAMTSVEKYSRQAADIQPTLRVLID----AVTRTFPMARYT 355
            ....:||   |....:...|.::.|    |:|..:|..||:
 Frog   245 KYCNNVE---RNLEKVSSKLHLVTDCMEHALTAVYPRTRYS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 90/272 (33%)
adh_short 96..293 CDD:278532 70/198 (35%)
rdh16NP_001107359.1 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 90/272 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1882
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.