DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and cideb

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001243186.1 Gene:cideb / 553467 ZFINID:ZDB-GENE-080514-2 Length:208 Species:Danio rerio


Alignment Length:154 Identity:35/154 - (22%)
Similarity:56/154 - (36%) Gaps:58/154 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KPFKIKDITRNIRKAVVATTLSELRTKVSLKFERAQPA------IHLDC--DGTEVDDEEYFSTL 175
            :||::....|.::|.:.|.||.||:       |||..|      :.|.|  ||||||.:|:...|
Zfish    21 RPFRVCSWNREVKKGITAGTLEELK-------ERAGQALLISKMLTLVCEEDGTEVDSDEFLIAL 78

  Fly   176 EPNAELIAVFPGEQWRDPSDYNANLRRTSLDAQRLRSLVSKLQPNYMNDDDLDKLSNMDPNSLVD 240
            ..|...:.:.|.|.|:                                           |:.|..
Zfish    79 PDNTVFMCLQPEEIWK-------------------------------------------PHPLHQ 100

  Fly   241 ITGREPKDNEYSARSDAARLSTEL 264
            ..|.:|.|::.....|.|:::.:|
Zfish   101 RGGNKPGDSKPRTGKDIAQITFDL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 27/80 (34%)
cidebNP_001243186.1 CIDE-N 20..93 CDD:280235 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm6534
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.