DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and cidea

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001007987.1 Gene:cidea / 493350 XenbaseID:XB-GENE-953574 Length:221 Species:Xenopus tropicalis


Alignment Length:117 Identity:35/117 - (29%)
Similarity:52/117 - (44%) Gaps:29/117 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 ALSPHS---SAT-------------PTPSPTTADEDFAQLDNSKPFKIKDITRNIRKAVVATTLS 140
            ||||.|   |.|             |.|.|.           .:||::.:..|:.:|.:||.||.
 Frog    10 ALSPKSLIRSVTNVGTSLTRRVLFPPLPEPP-----------QRPFRVSNSDRSSKKGIVAGTLK 63

  Fly   141 ELRTKVS--LKFERAQPAIHLDCDGTEVDDEEYFSTLEPNAELIAVFPGEQW 190
            ||..|.|  |........:.|:.|||.||.|::|.:||.|.:.:.:...::|
 Frog    64 ELIEKASETLFIHSDLVTLVLEEDGTVVDTEDFFQSLEDNTQFLLLEAKQKW 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 25/74 (34%)
cideaNP_001007987.1 CIDE_N 44..117 CDD:383014 24/72 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm9502
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.