DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and Cideb

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_006252064.1 Gene:Cideb / 364388 RGDID:1310000 Length:264 Species:Rattus norvegicus


Alignment Length:208 Identity:48/208 - (23%)
Similarity:82/208 - (39%) Gaps:52/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DSRIVAPPPRQRTLTRTAELDADCEDIE------------------LDA--DDGLDDAADSITLE 90
            ||.:..|..|.:..|:|.:......::.                  |.|  .:||..:..:::.|
  Rat     3 DSSLTLPELRSQLYTKTQDFSLHTTEVPSPEAIGGRLAVSHPAMEYLSALSSNGLLRSVSTMSSE 67

  Fly    91 LALSPHSSATPTPSPTTADEDFAQLDNSKPFKIKDITRNIRKAVVATTLSELRTKV--SLKFERA 153
            |:....:||.|.               .:||::.|..|.:||.:.|.|..||..||  :|.....
  Rat    68 LSRRVWNSAPPP---------------QRPFRVCDHKRTVRKGLTAATRQELLDKVVETLLLSGV 117

  Fly   154 QPAIHLDCDGTEVDDEEYFSTLEPNAELIAVFPGEQW------------RDPSDYNANLRRTSLD 206
            ...: |:.|||.|:.|::|..||.:..|:|:..|:.|            |:...::.::.|.:.|
  Rat   118 LTLV-LEEDGTAVETEDFFELLEDDTCLMALEQGQSWSPKSGMLSYGLGREKPKHSKDIARITFD 181

  Fly   207 A--QRLRSLVSKL 217
            .  |..|.|...|
  Rat   182 VYKQNPRDLFGSL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 26/86 (30%)
CidebXP_006252064.1 CIDE_N_B 79..159 CDD:119370 26/95 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5351
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.