DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and Drep1

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster


Alignment Length:160 Identity:83/160 - (51%)
Similarity:103/160 - (64%) Gaps:30/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DNSKPFKIKDITRNIRKAVVATTLSELRTKVSLKFERAQ--PAIHLDCDGTEVDDEEYFSTLEPN 178
            |:.||||:||:||||:|||.|::|.|:|:||:.|||:..  |.||||.||||:||||||.||:.|
  Fly     9 DSKKPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEEYFRTLDEN 73

  Fly   179 AELIAVFPGEQWRDPSDY--------------NANLR---------RTSLDAQRLRSLVSKLQPN 220
            .||:||||||.|.||:.|              |..|.         ..:.::.|:|.||.:||.|
  Fly    74 TELVAVFPGEHWIDPTHYVTITTPHGNEAGTGNGELNGGGEGDTTDANNSESARIRQLVGQLQNN 138

  Fly   221 -----YMNDDDLDKLSNMDPNSLVDITGRE 245
                 .|||.|||.||||||||||||||:|
  Fly   139 LCNVSVMNDADLDSLSNMDPNSLVDITGKE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 49/74 (66%)
Drep1NP_001260909.1 CAD 12..85 CDD:128562 48/72 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469260
Domainoid 1 1.000 58 1.000 Domainoid score I10758
eggNOG 1 0.900 - - E1_28MIP
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564672at2759
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm6534
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.