DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and Drep2

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001097238.1 Gene:Drep2 / 35955 FlyBaseID:FBgn0028408 Length:549 Species:Drosophila melanogaster


Alignment Length:96 Identity:36/96 - (37%)
Similarity:54/96 - (56%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 TPTPSPTTADEDFAQLDN--SKPFKIKDITRNIRKAVVATTLSEL--RTKVSLKFERAQPA-IHL 159
            |..||.:..:...:.:::  .:|.||.|..||:||.||..|..||  |.|..|....::|. :.|
  Fly    56 TTGPSSSVTNGGLSAMESRGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVL 120

  Fly   160 DCDGTEVDDEEYFSTLEPNAELIAVFPGEQW 190
            :||||:::|.|||.||..|..|:.:..||:|
  Fly   121 ECDGTQIEDGEYFRTLANNTVLLLLRQGERW 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 33/75 (44%)
Drep2NP_001097238.1 CIDE-N 76..152 CDD:280235 33/76 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6534
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.