DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and Cidea

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_038952597.1 Gene:Cidea / 291541 RGDID:1305106 Length:258 Species:Rattus norvegicus


Alignment Length:101 Identity:30/101 - (29%)
Similarity:52/101 - (51%) Gaps:8/101 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 SKPFKIKDITRNIRKAVVATTLSELRTKV--SLKFERAQPAIHLDCDGTEVDDEEYFSTLEPNAE 180
            ::||::.:..|:.|:.|:|::|.||.:|.  .|........:.|:.|||.||.||:|.||..|..
  Rat    77 ARPFRVSNHDRSSRRGVMASSLRELISKTLDVLVITTGLVTLVLEEDGTVVDTEEFFQTLRDNTH 141

  Fly   181 LIAVFPGEQWRDPSDY------NANLRRTSLDAQRL 210
            .:.:..|::|...:.|      .:.:.|.:.|..||
  Rat   142 FMILEKGQKWTPGNKYVCTQTKKSGIARVTFDLYRL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 25/74 (34%)
CideaXP_038952597.1 CIDE_N_A 76..153 CDD:119372 25/75 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11157
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5351
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm9088
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.